PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29726.m003959
Common NameLOC8262359, RCOM_0679130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 795aa    MW: 89176.9 Da    PI: 7.5541
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29726.m003959genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP113.98.9e-36146222177
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                    +Cqv+gCe+d+se+k yh+rh+vC  ++ a +vl++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k 
  29726.m003959 146 RCQVPGCEVDISELKGYHKRHRVCLRCATAGSVLLDGHRKRYCQQCGKFHLLPDFDEGKRSCRRKLERHNDRRRRKP 222
                    6************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-27140208IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.479144221IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-33145224IPR004333Transcription factor, SBP-box
PfamPF031106.3E-27147221IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
MEPSPPSPPP SAIARRPKKH DEMEIHASVT EDPTSSALWD WGDLLDFTVD DQFPISFDSI  60
DTTVSSEVYD NNNETNNHNP VIESTTRAVV QDRVRKRDPR LTCSNFLAGR VPCACPELDE  120
KLLEEEESLP GKKRVRTTRS SSGITRCQVP GCEVDISELK GYHKRHRVCL RCATAGSVLL  180
DGHRKRYCQQ CGKFHLLPDF DEGKRSCRRK LERHNDRRRR KPHDSKGTAV DKEIQGELQS  240
EETACEAEAG KDGQIIEKEA AVVESEDGNV SALHSDPNSQ NLNSDSGLSV GTPKRGGKDD  300
TKFSFSPSNC DNKSSYSSLC PTGRISFKLY DWNPAEFPRR LRHQIFEWLA SMPVELEGYI  360
RPGCTILTAF LAMPTFMWAK LFEDPMSYVH DLVIIPGKML SKRGPMLIYL NNMIFHVMKD  420
GNSVMKVNIE GRAPRLHYVH PTCFEAGKPI EFVACGSNLL QPKFRLLVSF SGKYLAYDYC  480
VALPHGHTEG CSGLDHQLCK IFIPHIEPNV FGPAFIEVEN ESGVSNFIPV LIGDREICSE  540
MKIIQQRFDA SHLPKGSQCE VSAQRQMAFS ELLVDIAWLL KKPSSESSQR IMSSSQIQRL  600
NSLLNFLLLH EATAILDKAL KNLKIILMET EREVSGSSDA DMKLLQKHVD WAWNILYQKV  660
KKRDGLLLQW ECTIQGRSSG KCSDGDGPSV APFTSEDLEK SSTGKLGLIA NTSDFVRSDK  720
VPLLNKEVVM NVNLVKDRPN QSCSLIFSKR VLRSRPTVFL IATVAVCFGV CAIILHPNQV  780
SRFAVSVRRC LTDRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A2e-43144229388squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1207219RRKLERHNDRRRR
2215221DRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002516839.10.0PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLB9RSX00.0B9RSX0_RICCO; Squamosa promoter-binding protein, putative
STRINGPOPTR_0008s20160.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64703450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7